kvikmyndamidstod.is

Scan Summary
F
Host:kvikmyndamidstod.is
Alexa Rank:435052
Server: Eplica
Start Time:2021-05-12 15:27:10
Duration:16 seconds
SSL:
Server Headers
HeaderValue
Date :Sat, 01 Jun 2019 06:44:33 GMT
Content-Type :text/html;charset=UTF-8
Transfer-Encoding :chunked
Connection :keep-alive
Server :Eplica
Powered-By :Eplica CMS 3
Last-Modified :Sat, 01 Jun 2019 06:42:21 GMT
Expires :Sat, 01 Jun 2019 07:32:21 GMT
X-UA-Compatible :IE=Edge
X-Frame-Options :SAMEORIGIN
Content-Security-Policy :frame-ancestors 'self'
X-Content-Type-Options :nosniff
X-XSS-Protection :1; mode=block
Cache-Control :public, must-revalidate, max-age=2868
Content-Language :is-IS
vary :accept-encoding
Set-Cookie :JSESSIONID=1797A14B770F1403709C0BCC419C080C; Path=/; HttpOnly
Set-Cookie :eplicaWebVisitor=1630704312; Version=1; Comment="Re-Authentication purposes only"; HttpOnly
Wrong Domain Names
uvikmyndamidstod.isjvikmyndamidstod.ismvikmyndamidstod.islvikmyndamidstod.is
ovikmyndamidstod.isivikmyndamidstod.iskcikmyndamidstod.iskdikmyndamidstod.is
kfikmyndamidstod.iskgikmyndamidstod.iskbikmyndamidstod.iskvukmyndamidstod.is
kvjkmyndamidstod.iskvkkmyndamidstod.iskvlkmyndamidstod.iskvokmyndamidstod.is
kviumyndamidstod.iskvijmyndamidstod.iskvimmyndamidstod.iskvilmyndamidstod.is
kviomyndamidstod.iskviimyndamidstod.iskviknyndamidstod.iskvikjyndamidstod.is
kvikkyndamidstod.iskvikmtndamidstod.iskvikmgndamidstod.iskvikmhndamidstod.is
kvikmjndamidstod.iskvikmundamidstod.iskvikmybdamidstod.iskvikmygdamidstod.is
kvikmyhdamidstod.iskvikmyjdamidstod.iskvikmymdamidstod.iskvikmynsamidstod.is
kvikmynwamidstod.iskvikmyneamidstod.iskvikmynramidstod.iskvikmynfamidstod.is
kvikmynvamidstod.iskvikmyncamidstod.iskvikmynxamidstod.iskvikmyndqmidstod.is
kvikmyndwmidstod.iskvikmyndsmidstod.iskvikmyndxmidstod.iskvikmyndzmidstod.is
kvikmyndanidstod.iskvikmyndajidstod.iskvikmyndakidstod.iskvikmyndamudstod.is
kvikmyndamjdstod.iskvikmyndamkdstod.iskvikmyndamldstod.iskvikmyndamodstod.is
kvikmyndamisstod.iskvikmyndamiwstod.iskvikmyndamiestod.iskvikmyndamirstod.is
kvikmyndamifstod.iskvikmyndamivstod.iskvikmyndamicstod.iskvikmyndamixstod.is
kvikmyndamidqtod.iskvikmyndamidatod.iskvikmyndamidztod.iskvikmyndamidxtod.is
kvikmyndamidctod.iskvikmyndamiddtod.iskvikmyndamidetod.iskvikmyndamidwtod.is
kvikmyndamidsrod.iskvikmyndamidsfod.iskvikmyndamidsgod.iskvikmyndamidshod.is
kvikmyndamidsyod.iskvikmyndamidstid.iskvikmyndamidstkd.iskvikmyndamidstld.is
kvikmyndamidstpd.iskvikmyndamidstos.iskvikmyndamidstow.iskvikmyndamidstoe.is
kvikmyndamidstor.iskvikmyndamidstof.iskvikmyndamidstov.iskvikmyndamidstoc.is
kvikmyndamidstox.is