gamekeyfinder.de

Scan Summary
F
Host: gamekeyfinder.de
Alexa Rank: 111612
Server: Apache/2.4.39 (Unix)
Start Time: 2022-12-09 23:24:27
Duration: 11 seconds
SSL:
Server Headers
Header Value
Date :Sat, 01 Jun 2019 10:03:05 GMT
Server :Apache/2.4.39 (Unix)
X-Powered-By :PHP/5.6.40
Vary :Accept-Language,User-Agent
Content-Language :de
Content-Type :text/html
Transfer-Encoding :chunked
Wrong Domain Names
ramekeyfinder.defamekeyfinder.devamekeyfinder.debamekeyfinder.de
namekeyfinder.dehamekeyfinder.deyamekeyfinder.detamekeyfinder.de
gqmekeyfinder.degwmekeyfinder.degsmekeyfinder.degxmekeyfinder.de
gzmekeyfinder.deganekeyfinder.degajekeyfinder.degakekeyfinder.de
gamwkeyfinder.degamskeyfinder.degamdkeyfinder.degamfkeyfinder.de
gamrkeyfinder.degameueyfinder.degamejeyfinder.degamemeyfinder.de
gameleyfinder.degameoeyfinder.degameieyfinder.degamekwyfinder.de
gameksyfinder.degamekdyfinder.degamekfyfinder.degamekryfinder.de
gameketfinder.degamekegfinder.degamekehfinder.degamekejfinder.de
gamekeufinder.degamekeyeinder.degamekeydinder.degamekeycinder.de
gamekeyvinder.degamekeybinder.degamekeyginder.degamekeytinder.de
gamekeyrinder.degamekeyfunder.degamekeyfjnder.degamekeyfknder.de
gamekeyflnder.degamekeyfonder.degamekeyfibder.degamekeyfigder.de
gamekeyfihder.degamekeyfijder.degamekeyfimder.degamekeyfinser.de
gamekeyfinwer.degamekeyfineer.degamekeyfinrer.degamekeyfinfer.de
gamekeyfinver.degamekeyfincer.degamekeyfinxer.degamekeyfindwr.de
gamekeyfindsr.degamekeyfinddr.degamekeyfindfr.degamekeyfindrr.de
gamekeyfindee.degamekeyfinded.degamekeyfindef.degamekeyfindeg.de
gamekeyfindet.de