livenettvapk.live

Scan Summary
F
Host: livenettvapk.live
Alexa Rank: 113063
Server: Apache
Start Time: 2024-05-27 10:07:41
Duration: 11 seconds
SSL:
Server Headers
Header Value
Date :Sat, 01 Jun 2019 06:50:05 GMT
Server :Apache
Vary :User-Agent,Accept-Encoding
Accept-Ranges :bytes
Content-Length :32674
Cache-Control :max-age=0, public
Expires :Sat, 01 Jun 2019 06:50:05 GMT
X-Powered-By :WP Rocket/3.1.1.1
Content-Type :text/html; charset=UTF-8
Wrong Domain Names
iivenettvapk.livekivenettvapk.livepivenettvapk.liveoivenettvapk.live
luvenettvapk.liveljvenettvapk.livelkvenettvapk.livellvenettvapk.live
lovenettvapk.livelicenettvapk.livelidenettvapk.livelifenettvapk.live
ligenettvapk.livelibenettvapk.livelivwnettvapk.livelivsnettvapk.live
livdnettvapk.livelivfnettvapk.livelivrnettvapk.livelivebettvapk.live
livegettvapk.livelivehettvapk.livelivejettvapk.livelivemettvapk.live
livenwttvapk.livelivensttvapk.livelivendttvapk.livelivenfttvapk.live
livenrttvapk.livelivenertvapk.liveliveneftvapk.livelivenegtvapk.live
livenehtvapk.liveliveneytvapk.livelivenetrvapk.livelivenetfvapk.live
livenetgvapk.livelivenethvapk.livelivenetyvapk.livelivenettcapk.live
livenettdapk.livelivenettfapk.livelivenettgapk.livelivenettbapk.live
livenettvqpk.livelivenettvwpk.livelivenettvspk.livelivenettvxpk.live
livenettvzpk.livelivenettvaok.livelivenettvalk.livelivenettvapu.live
livenettvapj.livelivenettvapm.livelivenettvapl.livelivenettvapo.live
livenettvapi.live