mycricketlive.net

Scan Summary
D
Host: mycricketlive.net
Alexa Rank: 3624
Server: GSE
Start Time: 2021-10-21 23:06:41
Duration: 2 seconds
SSL:
Server Headers
Header Value
Content-Type :text/html; charset=UTF-8
Expires :Sat, 01 Jun 2019 10:47:48 GMT
Date :Sat, 01 Jun 2019 10:47:48 GMT
Cache-Control :private, max-age=0
Last-Modified :Thu, 30 May 2019 08:09:13 GMT
X-Content-Type-Options :nosniff
X-XSS-Protection :1; mode=block
Server :GSE
Accept-Ranges :none
Vary :Accept-Encoding
Transfer-Encoding :chunked
Wrong Domain Names
nycricketlive.netjycricketlive.netkycricketlive.netmtcricketlive.net
mgcricketlive.netmhcricketlive.netmjcricketlive.netmucricketlive.net
myxricketlive.netmysricketlive.netmydricketlive.netmyfricketlive.net
myvricketlive.netmyceicketlive.netmycdicketlive.netmycficketlive.net
mycgicketlive.netmycticketlive.netmycrucketlive.netmycrjcketlive.net
mycrkcketlive.netmycrlcketlive.netmycrocketlive.netmycrixketlive.net
mycrisketlive.netmycridketlive.netmycrifketlive.netmycrivketlive.net
mycricuetlive.netmycricjetlive.netmycricmetlive.netmycricletlive.net
mycricoetlive.netmycricietlive.netmycrickwtlive.netmycrickstlive.net
mycrickdtlive.netmycrickftlive.netmycrickrtlive.netmycrickerlive.net
mycrickeflive.netmycrickeglive.netmycrickehlive.netmycrickeylive.net
mycricketiive.netmycricketkive.netmycricketpive.netmycricketoive.net
mycricketluve.netmycricketljve.netmycricketlkve.netmycricketllve.net
mycricketlove.netmycricketlice.netmycricketlide.netmycricketlife.net
mycricketlige.netmycricketlibe.netmycricketlivw.netmycricketlivs.net
mycricketlivd.netmycricketlivf.netmycricketlivr.net